Protein Info for ABI39_RS01185 in Phocaeicola dorei CL03T12C01

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF08240: ADH_N" amino acids 24 to 131 (108 residues), 114.7 bits, see alignment E=3.8e-37 PF16912: Glu_dehyd_C" amino acids 142 to 323 (182 residues), 40.6 bits, see alignment E=4.1e-14 PF01262: AlaDh_PNT_C" amino acids 163 to 237 (75 residues), 23.1 bits, see alignment E=8.8e-09 PF00107: ADH_zinc_N" amino acids 172 to 297 (126 residues), 94.7 bits, see alignment E=9e-31

Best Hits

KEGG orthology group: None (inferred from 94% identity to bvu:BVU_0222)

MetaCyc: 94% identical to L-galactonate 5-dehydrogenase (Phocaeicola vulgatus ATCC 8482)
RXN0-5229 [EC: 1.1.1.414]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.414

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABI39_RS01185 zinc-binding alcohol dehydrogenase family protein (Phocaeicola dorei CL03T12C01)
MKAIQITAPSEMKVVDIEKPALKPGEVLVKIKYVGFCGSDLNTFLGRNPMVKLPVIPGHE
VGAIIEAIGKDVPESLKPGMSVTVNPYTNCGKCASCRNGRVNACEHNETLGVQRNGAMCE
YIALPWNKIIPASHISPRDCALIEPMSVGFHAVSRAQVTDIDTVMIIGCGMIGMGAIVRS
TLRGATVIAVDLDDEKLELAKRVGAHHTINSMTENVHERLTKITEGFGPDVVIEAVGSPA
TYVMAVNEVGFTGRVVCIGYAKSEVSFQTKYFVQKELDIRGSRNALPADFRAVIRYMEQG
TCPKDELISKVAKPETALQAMEEWAKAPGKVFRILVEFD