Protein Info for ABI39_RS00245 in Phocaeicola dorei CL03T12C01

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00460: methionyl-tRNA formyltransferase" amino acids 6 to 317 (312 residues), 268.4 bits, see alignment E=3.9e-84 PF00551: Formyl_trans_N" amino acids 7 to 181 (175 residues), 122.1 bits, see alignment E=2.3e-39 PF02911: Formyl_trans_C" amino acids 213 to 316 (104 residues), 81.4 bits, see alignment E=4.6e-27

Best Hits

Swiss-Prot: 98% identical to FMT_BACV8: Methionyl-tRNA formyltransferase (fmt) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 98% identity to bvu:BVU_0054)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>ABI39_RS00245 methionyl-tRNA formyltransferase (Phocaeicola dorei CL03T12C01)
MEKKDLRIVYMGTPDFAVESLKRLVEGGYNVVGVITMPDKPMGRHGSVLQPSPVKEYAVS
QGLRVLQPEKLKDEAFVEELRSLQADLQIVVAFRMLPEIVWNMPRLGTFNLHASLLPQYR
GAAPINWAVINGDTETGITTFFLKHEIDTGEIIQQVRVPIADTDNVEIVHDKLMYLGGDL
VLETVDAILDGSVKPVPQENLIRQETELRPAPKIFKETCRIDWNKGVKQIYDFIRGLSPY
PAAWTELCVADGTRQVLKIYETEKVFVSHEMNIGDIRTDMKTYFQVAVKDGFINVLTLQL
AGKKRMNVADFLRGYRTSDNNKVE