Protein Info for ABI39_RS00100 in Phocaeicola dorei CL03T12C01

Annotation: radical SAM family heme chaperone HemW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00539: putative oxygen-independent coproporphyrinogen III oxidase
  • amino acids 4 to 348 (345 residues), 290.8 bits, E=7.8e-91
• PF04055: Radical_SAM
  • amino acids 6 to 174 (169 residues), 85.7 bits, E=4.3e-28
• PF06969: HemN_C
  • amino acids 302 to 363 (62 residues), 26.3 bits, E=6.2e-10

Best Hits

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 91% identity to bvu:BVU_0018)

Predicted SEED Role

"Hypothetical radical SAM family enzyme in heat shock gene cluster, similarity with CPO of BS HemN-type"

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.22

Protein Sequence (376 amino acids)

>ABI39_RS00100 radical SAM family heme chaperone HemW (Phocaeicola dorei CL03T12C01)
MAGIYLHIPFCKKRCIYCDFFSTTRKEQKTAYIRALCHELTDRKDYLKGEPIETIYLGGG
TPSQLAKEDFEAIFSHIYKVYKVTPNAEITLEANPDDLTSEYISMLRTFPFNRISMGIQT
FQETTLKQLQRRHTADQAIRAFQGCRTAGFQNISIDLMYGLPGETLTSWKKDLKQALSLH
PEHISAYHLIYEEGTPLWKLREQHKVEEADEDLSVSLFGTLIDELTTAGYEHYEISNFCL
PGLHSRHNSSYWTEKQYLGCGPSAHSYNGISRQWNVASLDKYIEGISSGNPTFEVEELDL
YTRYNDFVITHIRTQWGMPLPKLGKQYGEELYKYCLHMATPHLQQGTLEIKNDTLKLTRK
GVFISDGIMSDMLWAE