Protein Info for A4249_RS17085 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sugar O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF12464: Mac" amino acids 6 to 51 (46 residues), 37.7 bits, see alignment E=3e-13 PF14602: Hexapep_2" amino acids 126 to 161 (36 residues), 39.2 bits, see alignment 6.7e-14 PF00132: Hexapep" amino acids 127 to 161 (35 residues), 43.2 bits, see alignment 3e-15

Best Hits

Swiss-Prot: 46% identical to Y5913_DICDI: Putative acetyltransferase DDB_G0275913 (DDB_G0275913) from Dictyostelium discoideum

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 54% identity to eba:ebA2867)

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY74 at UniProt or InterPro

Protein Sequence (183 amino acids)

>A4249_RS17085 sugar O-acetyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTEREKMLAGLPYDPGDSDLRDGRARAVALTVAINAEPDRDRRGALVNELVNAADGKAII
MPGFFCDYGVNIHLGARAFANANCVFLDCAEIRIGDNFQAGPGVQLLTPEHPLDAVARRG
EETARPIVIGDDVWIGGGAIVLAGVTIGDRSVIGAGSVVTKDVPSDVVVVGNPAKIVRRL
TPA