Protein Info for A4249_RS16865 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 21 to 199 (179 residues), 94 bits, see alignment E=4.9e-31

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 49% identity to pzu:PHZ_c1589)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N8H5 at UniProt or InterPro

Protein Sequence (239 amino acids)

>A4249_RS16865 cytochrome b (Brevundimonas sp. GW460-12-10-14-LB2)
MIERLFRQLLEWAAGHHDEGRYSPVGIGFHWVMAVLVIFQLGWGWWMGRQPVGGAMMAAY
DLHFAIGVLMLILVIGRLSWRLLAPDLINDADKPGWESMAAHVTHYVFYICLFGLPLSGW
AMVSATDRTRQLETLGFIKWPLLPLQDLSNTQLWAIEAAAEWMHWGLVITLLLMIPIHAG
AALKHHLIDRDDVFHAMLPVVPQLRPKRTRWQRRWRALEKRVASTARTLWRGLLGPKAI