Protein Info for A4249_RS16355 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00403: HMA" amino acids 42 to 102 (61 residues), 51.7 bits, see alignment E=4.6e-18

Best Hits

KEGG orthology group: None (inferred from 52% identity to sal:Sala_2684)

Predicted SEED Role

"Periplasmic mercury(+2) binding protein" in subsystem Mercury resistance operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>A4249_RS16355 cation transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MKKTFLIGLAVVAVAGVGAAVAFDGPAQNRPAATAAAQQQTTFAIEHMTCATCPITVRRA
MESVPGVNSVEVDFAAKTARATYDPARATAAQIAAASTNAGYPARVVQN