Protein Info for A4249_RS16015 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: flagellar biosynthetic protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details PF04347: FliO" amino acids 25 to 78 (54 residues), 31.7 bits, see alignment E=6.9e-12

Best Hits

Swiss-Prot: 56% identical to Y952_CAUVC: Uncharacterized protein CC_0952 (CC_0952) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 91% identity to bsb:Bresu_2995)

Predicted SEED Role

"fliO protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NV91 at UniProt or InterPro

Protein Sequence (96 amino acids)

>A4249_RS16015 flagellar biosynthetic protein FliO (Brevundimonas sp. GW460-12-10-14-LB2)
MNFLDLARAVFGLAFTLGLIGIAAWAARRYAPQILARLNAERGERRLQVVETLVLDPARR
LVLVRVDDEERLILLGEGRELIEPRQPPVGKVGGGQ