Protein Info for A4249_RS15930 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF3667 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 104 to 125 (22 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 352 to 378 (27 residues), see Phobius details PF12412: DUF3667" amino acids 75 to 119 (45 residues), 60.2 bits, see alignment 5.4e-21

Best Hits

Predicted SEED Role

"FIG00449573: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I297 at UniProt or InterPro

Protein Sequence (380 amino acids)

>A4249_RS15930 DUF3667 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MDIEGAGAVVTSGLVAGAIEKPTGKAGEDHAHGVCSDCGAETSGNFCANCGQPTHVHRSL
LHLGEELLHGVMHFDARIWRTLPLLWLNPGRLTREWVEGKRTRFVSPLAIFLFTLFVMFF
ALSFMPHPESKSGEAAEMSERIASQRVGLAEAEKALVQMRAESGAQPDPTMQMAINAGQK
LVDDRRAALARLEIEQRDGRADGLKPGSWQAGIKDMATGESGETKLKVMGKDAKKEGHGI
GATVLKKLQNPDLAVYKFQQTVYKFAFLLVPLSIPFVALLFLWKRGFTLYDHGVFVLYSL
TFMAMLLMLMVLSATIAGWLGAIVIPLGLLAVPVHVFAQMKGAYSLSWFSALWRTIALLV
FCNIVVGLFFAAIVYLGLGH