Protein Info for A4249_RS15920 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 26 to 433 (408 residues), 416.6 bits, see alignment E=5.9e-129 PF04052: TolB_N" amino acids 33 to 131 (99 residues), 86.2 bits, see alignment E=3.3e-28 PF07676: PD40" amino acids 254 to 278 (25 residues), 24.1 bits, see alignment (E = 5.4e-09) amino acids 287 to 322 (36 residues), 49.8 bits, see alignment 4.7e-17 amino acids 331 to 361 (31 residues), 21.3 bits, see alignment (E = 4e-08) amino acids 374 to 409 (36 residues), 23.5 bits, see alignment 8.4e-09

Best Hits

Swiss-Prot: 49% identical to TOLB_RHILW: Tol-Pal system protein TolB (tolB) from Rhizobium leguminosarum bv. trifolii (strain WSM2304)

KEGG orthology group: K03641, TolB protein (inferred from 75% identity to bsb:Bresu_0863)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NV00 at UniProt or InterPro

Protein Sequence (454 amino acids)

>A4249_RS15920 Tol-Pal system beta propeller repeat protein TolB (Brevundimonas sp. GW460-12-10-14-LB2)
MRLNLLLASVAAVAMAAPLTTAAQTPQQNQPVEVEIDQGVLRPLQIAVVPFAGTHGSDIS
NVVSANLKRSGFFEPLNPSSFIETGLTLANAPNFPQWTQIGAQAVLYGGVTTRGDGRLDV
GFRLYDPYRQCQLVSYQFTATQEQWRRIAHKISDVIYQRMTGEAGFFDSRVIFVSEEGTP
LNRINRLTIADQDGFNPTYLTQGDEVIMSPRFSLSQPDEITYVALGKDYSRIYLYNLTTG
RRESLGEFDGQVLAPRFSNDGNKIAFSIIRGGNTDVYVMDLRSRQITRLTSDPGIDTSPS
FSPDGSQIVFTSDRSGSARLYVMRSDGSGQRPISRGGGIYTAPSWSPTGNLIAFTKQGGG
RFSTGVMNADGSGERILSSSYFEEGPNWAPNGRYVMFARQTPGGDTRLWTVDLSGRVVSQ
AGYNGRGTDPAWSPLLDRGPSNLGVNQGADSCPA