Protein Info for A4249_RS15900 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ExbD/TolR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details PF02472: ExbD" amino acids 21 to 145 (125 residues), 99 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 39% identical to EXBD_PSEPU: Biopolymer transport protein ExbD (exbD) from Pseudomonas putida

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 76% identity to bsb:Bresu_0861)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2A1 at UniProt or InterPro

Protein Sequence (150 amino acids)

>A4249_RS15900 ExbD/TolR family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MALGGGASGGGRRGRRGRKGPLTEINVTPLVDVMLVLLIIFMISAPLLTVGVPVELPKTE
ASAVEIKSEPLSVSIDQQGAIFVGDSETAFDALSTRLLTEAGGADKAAERPVFVRADGRA
PYQAVARVMARLSASGFTKLNLITDTAPEA