Protein Info for A4249_RS15895 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 13 to 226 (214 residues), 234.4 bits, see alignment E=6.2e-74 PF01618: MotA_ExbB" amino acids 114 to 213 (100 residues), 110.6 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 80% identity to bsb:Bresu_0860)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NUY4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>A4249_RS15895 protein TolQ (Brevundimonas sp. GW460-12-10-14-LB2)
MTTPVDAAMMNPVELFMTADWVVKSVMIGLAAASIWSWTIIIDKAVRFTALNKRADEFEK
SVQSGRSLEEVASQAGPDPDHALPRMLVIALSDWREARQRGALNEHQGELLLVRIDKAMN
SLISREGQRIENGLGVLSVVATASPFIGLFGTVWGIMNAFGRIAAAGNTNLTTVAPAIAE
ALFATAIGLAAAIPAYIAYNKFSIDAGKFTGRLEAFADDLQAAVARRLGSPSAPPPPPPP
PSDLSLKRGV