Protein Info for A4249_RS15850 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MgtC/SapB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details PF02308: MgtC" amino acids 14 to 143 (130 residues), 125.6 bits, see alignment E=7.2e-41

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 68% identity to bsb:Bresu_3188)

Predicted SEED Role

"Uncharacterized membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IJA9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>A4249_RS15850 MgtC/SapB family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MNLGSLEGAVLPILGAVIAGGVIGFEREWRGRAAGLRTHILVSLASALLMLAAMSQADWA
FRALPDENIVTDPTRMAHGVLTGIGFLCAGVIFRTGFSIHGLTTAASLWITSAIGILFGA
GLYALGTAATVVTALILIGLRLINGRLPARTVVDAEVCWERREASPEPAIEAALKAIDAD
ARHDRFELIDGQTIRRTWRLKAAEESQLKRLAEQLCAIPGVVAYSLDPRDD