Protein Info for A4249_RS15840 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 244 (244 residues), 256.9 bits, see alignment E=1.1e-80 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 107.4 bits, see alignment E=4.2e-35 PF01709: Transcrip_reg" amino acids 81 to 244 (164 residues), 169 bits, see alignment E=7e-54

Best Hits

Swiss-Prot: 68% identical to Y3068_PHEZH: Probable transcriptional regulatory protein PHZ_c3068 (PHZ_c3068) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: None (inferred from 91% identity to bsb:Bresu_3191)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I296 at UniProt or InterPro

Protein Sequence (257 amino acids)

>A4249_RS15840 YebC/PmpR family DNA-binding transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MAGHSKFKNIMHRKGRADAQRSKLFSKLSRDITVAAKSGLPDPAANPRLRLAVNNAKAES
LPKDVIQRAINKAAGGDVDTMEEVRYEGRGPGGVGIIVEALTDNRNRAASNIGAAFKKNG
GALSEMNSVAFMWDKVGKITYAAEAGSEDAVMEAAIEAGAQDVESDLVKPDIYEDAPGHT
IWTAFEDLNDVAEAMSKVLGDPKSTAIVWKPQSEVPVTGEAVGTLFKLLDALDAEDDVSA
VYSNEDISDEDAAKYAG