Protein Info for A4249_RS15830 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: arsenic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 34 to 35 (2 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 377 to 389 (13 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details TIGR00935: arsenite/antimonite efflux pump membrane protein" amino acids 2 to 427 (426 residues), 667.4 bits, see alignment E=5.4e-205 PF02040: ArsB" amino acids 4 to 422 (419 residues), 482.4 bits, see alignment E=1.7e-148 PF03600: CitMHS" amino acids 13 to 368 (356 residues), 203.3 bits, see alignment E=5.9e-64

Best Hits

Swiss-Prot: 71% identical to ARSB2_ECOLX: Arsenical pump membrane protein (arsB) from Escherichia coli

KEGG orthology group: K03893, arsenical pump membrane protein (inferred from 78% identity to rpa:RPA2258)

MetaCyc: 70% identical to arsenite/antimonite:H+ antiporter (Escherichia coli K-12 substr. MG1655)
RXN-22385; RXN3O-9786

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IXS3 at UniProt or InterPro

Protein Sequence (427 amino acids)

>A4249_RS15830 arsenic transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MIVAFLIFVVTITLVIWQPKGLQIGWSAMGGAAAALLLGVVTLADIPVVWDIVWNATATF
VAIIIISLLLDEAGFFEWAALHVGRWGGGQGRRLFVLFVLLGAAVSAVFANDGAALILTP
IVIAMLLALGYGPKATLAFVMAAGFIADAASLPLVVSNLVNIVSADFFDIGFDRYTAVMA
PVNLASIAATLMVLFVVFGRDIPKAYDVERLAAPSSAIKDRATFLWGWIILALLLIGFFV
LEPRGVPVSAVAATGAVVLLVMAGRGAVISTTKVLREAPWQVVIFSLGMYLVVYGLGNAG
LTRQIAGLLDGFSQGGVWGTAFGTGFLTAFLSAIANNMPTVLIGALSIDASGATGAAREA
MIYANVIGSDLGPKMTPIGSLATLLWLHVLARKGVKIGWGYYFKVGVVLTLPVLGVALAA
LALRLSV