Protein Info for A4249_RS15650 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: potassium-transporting ATPase subunit KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details amino acids 421 to 445 (25 residues), see Phobius details amino acids 489 to 513 (25 residues), see Phobius details amino acids 529 to 553 (25 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 561 (561 residues), 689.7 bits, see alignment E=1.5e-211 PF03814: KdpA" amino acids 11 to 560 (550 residues), 735.5 bits, see alignment E=1.5e-225

Best Hits

Swiss-Prot: 75% identical to KDPA_CAUSK: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Caulobacter sp. (strain K31)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 80% identity to bsb:Bresu_3242)

MetaCyc: 51% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NUB5 at UniProt or InterPro

Protein Sequence (569 amino acids)

>A4249_RS15650 potassium-transporting ATPase subunit KdpA (Brevundimonas sp. GW460-12-10-14-LB2)
MNIQGWGEIALTLGLAVMLGWPIGVYMSRVWNGERTWLDPVLKPVEAVFYGAAGVDPKRS
QGWLGYAGALLAFNLAGFVLLYAILRLQGVLPLNPQGFAGVSPHLAFNTAVSFVTNTNWQ
SYGGEATLSTFTQMVGLTVQNFVSAATGATIAAALARAFVANRGEGVGNFWADLTRTTLY
VLLPAALILAVALAGLGIVQSLAAHVTATGIEGGSQTLPLFPAASQVAIKQLGINGGGVF
NVNGAHPFENPNAITNLLTAVAINVMGWAAFFAFGRTAMAGRDIRALAAAALILLSAASA
AMYLIETQPAPALVAAQVDASVNMEGKEVRFGAPASTVWSVVTTGASNGSVNSMHASFMP
LGGGLQMFLMQLGEILPGGVGSGIAIMVVMALLSVFVAGLMVGRTPEYLGKKIEAREIQF
AMIAVLILPLAILGFTAVSAVFPTALAGLLNKGPHGLSEILYAYTSAAANNGSAFAGLTA
NAPWWNTTLGLGMLFGRFIPAVAVLAIAGSLVVKPKLAPSPGTLPTDNGLFIGLLIGVVL
ILGGLQFLPALALGPIVEHFQVLAAVAGA