Protein Info for A4249_RS15585 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF00072: Response_reg" amino acids 10 to 121 (112 residues), 89.8 bits, see alignment E=6.8e-30

Best Hits

Swiss-Prot: 52% identical to CHEY_RHIEC: Probable chemotaxis protein CheY (cheY) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 74% identity to pzu:PHZ_c3375)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I260 at UniProt or InterPro

Protein Sequence (129 amino acids)

>A4249_RS15585 response regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MPAAASLHCLVVDDQMTMRSLVRTSLQQLGVREIREAADGEIALREIVSKPAHLIISDYN
MPNLDGLGLLRAVRAHPPTSKTAFIMLTGRADRELVQRAVQFGVNNYLVKPFTVAQLKGK
LEAVFGPLT