Protein Info for A4249_RS15480 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: histidine kinase dimerization/phosphoacceptor domain -containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 PF08446: PAS_2" amino acids 15 to 122 (108 residues), 40.5 bits, see alignment E=1.3e-13 PF01590: GAF" amino acids 151 to 311 (161 residues), 55.5 bits, see alignment E=2.7e-18 PF00360: PHY" amino acids 328 to 503 (176 residues), 157.7 bits, see alignment E=6.3e-50 PF07536: HWE_HK" amino acids 535 to 587 (53 residues), 25.8 bits, see alignment 4.3e-09 PF07568: HisKA_2" amino acids 535 to 609 (75 residues), 70.2 bits, see alignment E=3.8e-23 PF13581: HATPase_c_2" amino acids 628 to 681 (54 residues), 27.9 bits, see alignment 6.2e-10

Best Hits

KEGG orthology group: None (inferred from 51% identity to xau:Xaut_2444)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0F3 at UniProt or InterPro

Protein Sequence (724 amino acids)

>A4249_RS15480 histidine kinase dimerization/phosphoacceptor domain -containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTETLDLADAALNECDREPIHIPQSIQPHGFMLVLDLQSLTIRQGAGAIEELTGRKVWID
RTVADVLGDVADRAVRAMAAHQEAGFACRWRATNRLEYDVVAHRAPGTTSGTINDLMIIE
VEQSSQQARLGVDLIANLDAAGAALERAVTIQTVCERAADAFRRLTGFDRVMIYRFQDDE
AGQVVAESRADGSGSFLNHHFPATDIPQQARALYLRNPVRVIPDSRYTPQPLRPIAPGEA
PLDMSDSGLRSVSPIHLQYLRNMDVRASASVSIIVDDALWGLVACHNASPKLLPYELRVG
CTALARNLARQLKSKTDADLYRERTRLRRMEDELLSRLSPDRPMREALAEKADALMQLTS
ADGLAIVRDGDIETFGHTPPEDGVRAIAAWAAGRPGLRPVSSHNLASVLPAAEAWKTHAS
GLLAVTLPLDQPVSLLWFRSEVLETVRWAGNPSTAEKTGPNAILTPRASFESWSDTVSGR
AHRWGPAAVESAARLRDALADYAAVHQIRRLNRSLQDRLSERDLRLEQQQYLIREVNHRV
QNSLTLVSSFLGLQAREQAGGSAATALNEARRRVRAVSAVHSRLYLSDQVTTIDMSRYIG
ELIGDLGSSMGPDWAAAIETDLDPVCIEPGRAITIGLILTELIINAQKYAYGGKPGPLRI
AFQEDGAFFRMTVEDEGAGGHLAGKGFGSMMIKSLVGQLDGTIDYRDRAPGLSVALRSRI
DPLV