Protein Info for A4249_RS15475 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 285 (17 residues), see Phobius details PF00892: EamA" amino acids 14 to 139 (126 residues), 48.5 bits, see alignment E=5e-17 amino acids 152 to 284 (133 residues), 61.1 bits, see alignment E=6.7e-21

Best Hits

KEGG orthology group: None (inferred from 76% identity to bsb:Bresu_1095)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I246 at UniProt or InterPro

Protein Sequence (309 amino acids)

>A4249_RS15475 DMT family transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MSALAFRPSSRAFALIVLLIAASVLGLAPILVRLTETGPAAAGFWRFLFALPLLTILASR
EPGGVGVPSKWALLAGLFFALDLSFWHYGIVMTSVANATVLCNLTPVVVTLFGWFVLKER
PHRLFILALALAMGGAFAMAAGSDGGQGTNPMLGDLFSLSVAVWYSGYFLAVQAARRTAG
AMRVTFWATLLGAPLLLIVALALGEDVIPAGPAGWAACVGMGVMHVFGQGGVAWALGKLP
ASVTAVTILIQPVVAGLLGWWIFGETLTPVQALGGALVLGAIVLAQRSQRTKTVQAAETK
PQDASNGLK