Protein Info for A4249_RS15460 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03707: polyphosphate kinase 2
  • amino acids 4 to 228 (225 residues), 336.2 bits, E=5.2e-105
• PF03976: PPK2
  • amino acids 4 to 225 (222 residues), 310.5 bits, E=3.7e-97

Best Hits

Swiss-Prot: 51% identical to PK21_MYCS2: Polyphosphate:GDP phosphotransferase (MSMEG_0891) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 67% identity to bsb:Bresu_1092)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

See A0A160I1N9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>A4249_RS15460 polyphosphate kinase 2 (Brevundimonas sp. GW460-12-10-14-LB2)
MGKKSDAYDAELEQIQLAIVQTQAWSIEHGSRVVIVLEGRDTAGKDGAIKRLTEHMSPRQ
TRVIALPKPSDRETSQWYFQRYVPHLPAAGETVIFNRSWYNRAGVEPVMGYCTPEQYAQF
MTDAPRFERMLTDDGIILIKIWLDISRKEQAKRLKERREDPLKKFKLSSLDAEAEARFDA
YSDARDRMLGETDRDYAPWTVVATDDKKTARLNIGRYILSVLSHTSIDIRKPDPDVVFSA
GKAKGKLAR