Protein Info for A4249_RS15385 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 2,3-diphosphoglycerate-dependent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR01258: phosphoglycerate mutase 1 family" amino acids 3 to 227 (225 residues), 298.4 bits, see alignment E=1.9e-93 PF00300: His_Phos_1" amino acids 4 to 128 (125 residues), 99.9 bits, see alignment E=7.7e-33 amino acids 140 to 206 (67 residues), 22.9 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 80% identical to GPMA_CAUSK: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Caulobacter sp. (strain K31)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 88% identity to bsb:Bresu_0271)

MetaCyc: 51% identical to phosphoglycerate mutase (Saccharomyces cerevisiae)
RXN-15513 [EC: 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I251 at UniProt or InterPro

Protein Sequence (237 amino acids)

>A4249_RS15385 2,3-diphosphoglycerate-dependent phosphoglycerate mutase (Brevundimonas sp. GW460-12-10-14-LB2)
MPRLILLRHGQSQWNLENRFTGWVDVDLTAEGEAQARRGGELIAEAGFKPTVMFTSVLTR
AQRTGALALQSAGLTDVPVIEDWRLNERHYGGLTGLNKAETAQKHGEDQVKIWRRSYDVP
PPPLAPGGEFDFNADPRYAGKAIPDTESLKTTLDRVKPYWDAEIAPRLKAGEDVLIAAHG
NSLRAIVKLLFGVPDDEIVGVEIPTGNPLEIDLDANLKPTAARYLDAARAETLPTSS