Protein Info for A4249_RS15370 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF11638: DnaA_N" amino acids 15 to 75 (61 residues), 42.2 bits, see alignment E=1.3e-14 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 17 to 482 (466 residues), 417.5 bits, see alignment E=3.8e-129 PF00308: Bac_DnaA" amino acids 142 to 363 (222 residues), 240.3 bits, see alignment E=5.8e-75 PF01695: IstB_IS21" amino acids 169 to 275 (107 residues), 32.2 bits, see alignment E=2.1e-11 PF00004: AAA" amino acids 179 to 273 (95 residues), 32.7 bits, see alignment E=2.4e-11 PF08299: Bac_DnaA_C" amino acids 393 to 461 (69 residues), 109.3 bits, see alignment E=1.9e-35

Best Hits

Swiss-Prot: 41% identical to DNAA_SPHAL: Chromosomal replication initiator protein DnaA (dnaA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 85% identity to bsb:Bresu_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161I785 at UniProt or InterPro

Protein Sequence (484 amino acids)

>A4249_RS15370 chromosomal replication initiator protein DnaA (Brevundimonas sp. GW460-12-10-14-LB2)
MAGGTKTSGLTDPDRIWSEASVRLRAEIGDGPFSSYIAPSAVRLDNAGHLILVTPTAYAR
DWVRKNALRRMNELWLGLDGLSRRLEVRCRAEVGSAPPASAVMPGNVVDAAPRLAAFAAT
PQMAPAAPISADGARAVRAAGLQDRLTFDSFVEGQGNAFALAIAKQVASWADGHFNPVFF
CGPYGYGKTHLLNAIAWEAQRLRPEAKVVYLTAERFLSTFVKAMQDRSTAAFKESLRSAD
MLLLDDVQFVGGKTSTQEELLSTLTALIEDGKRIVFSADRAPMALTEVEPRLRSHLAAGL
TCPVEAGDRELKIAVAQNRLKALSALGVVQGEANPEVLAQLVDRTPGSMRELEGAVNTLA
AAAGARLSSVSVDEASTLLGMAMRGGPERRITVDEIQKTVADHFNMKQADLLSERRTRSV
ARPRQIAMYLCKQHTTRSYPDIGRRFGGRDHTTVLHGVRKIEELMPQDDQIARDVEALTR
KLRG