Protein Info for A4249_RS15340 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details PF05430: Methyltransf_30" amino acids 112 to 233 (122 residues), 132.1 bits, see alignment E=2.1e-42 PF01266: DAO" amino acids 244 to 572 (329 residues), 133.9 bits, see alignment E=2.1e-42 PF13450: NAD_binding_8" amino acids 247 to 284 (38 residues), 22.3 bits, see alignment 2.7e-08

Best Hits

Predicted SEED Role

"putative peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1M8 at UniProt or InterPro

Protein Sequence (610 amino acids)

>A4249_RS15340 tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD (Brevundimonas sp. GW460-12-10-14-LB2)
MTPDDDASPLLTWTEEGEPRSGRFGDVYFSRDDGLAETRAVFLEGCGLPDAWMGRDHFTV
AELGFGTGLNIAALLYLWRRTRPEGGRLHIFSIEGFPLTAAEAARALGAWPALAEATEAL
IANWPAATPGFHRVDLPGFDAVLDLAVGDAAWALEQWSGVADAWFLDGFSPALNPGMWSP
EVMALIAERSAPGARLATFTVAGAVRRGLAGQGFIVEKRPGHGRKRERLEARLPSVFEPS
PPPRVAVIGAGIAGASVARALKAQGLRAVVFEGERPGAGGSGFPAALVTPRLDAGDLGIA
ALHAQALERTAHLYASIPDAVTGHGVLQLPQALRDAVRFEKIARQPIWNDVDMAVLDEGA
ASAVAGEATGQGGLLMKGAFAVRPATVLSKWFSDAETRSERVTRLERADGRWRLIGEADV
VLGEVDAVVLAAGWGSAALLEGFDQTPRLSPVRGQADWIDGDVTIHPMAWGGYAVPTGQG
VLFGATHDRGDTDTAPREDDGVRNLATLEARLPALAKRITAAGPVQHRAAVRATTPDRLP
VAGALDDGLYVLGGLGSRGFCVAPLLGEHVAAVILDQPSPLPRDLAARVSPRRSAVLTDG
LASFSPTRAG