Protein Info for A4249_RS15330 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: flagellar motor stator protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 283 (283 residues), 372.5 bits, see alignment E=5.7e-116 PF20560: MotA_N" amino acids 4 to 95 (92 residues), 104 bits, see alignment E=4e-34 PF01618: MotA_ExbB" amino acids 131 to 240 (110 residues), 61.1 bits, see alignment E=9.3e-21

Best Hits

Swiss-Prot: 40% identical to MOTA_RHIME: Motility protein A (motA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 86% identity to bsb:Bresu_3156)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NZC6 at UniProt or InterPro

Protein Sequence (288 amino acids)

>A4249_RS15330 flagellar motor stator protein MotA (Brevundimonas sp. GW460-12-10-14-LB2)
MFQIIGIVLLFGLVFGSYAISGGKFEVILHAAPHELMAIGGAGIAAFLISNSLPVIKGSM
AGLGKTFAGPKWKKQDYKDLLSLLFQLTKTMKSKGVVALESHIEKPKESTIFQKYPKVLK
DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEHLENAHALQNLADGLPALGIV
AAVLGVIKTMGSITEPPEVLGGMIGGALVGTFMGVFLAYGLVGPFAARLTAIINEEAAYY
KIIQSVLVAHLHGNAAQISVEIGRGDIPSSAQPSFGEMEEALNSITAD