Protein Info for A4249_RS15190 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: acetate--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02188: acetate--CoA ligase
  • amino acids 26 to 646 (621 residues), 998.4 bits, E=5.8e-305
• PF16177: ACAS_N
  • amino acids 30 to 87 (58 residues), 63.1 bits, 2.5e-21
• PF00501: AMP-binding
  • amino acids 92 to 471 (380 residues), 292.5 bits, E=6.5e-91
• PF13193: AMP-binding_C
  • amino acids 534 to 612 (79 residues), 91 bits, E=1.2e-29

Best Hits

Swiss-Prot: 74% identical to ACSA_PARL1: Acetyl-coenzyme A synthetase (acsA) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K01895, acetyl-CoA synthetase [EC: 6.2.1.1] (inferred from 84% identity to bsb:Bresu_2881)

MetaCyc: 58% identical to acetate--CoA ligase (Syntrophus aciditrophicus)
Acetate--CoA ligase. [EC: 6.2.1.1]

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• superpathway of acetate utilization and formation (2/3 steps found)
• chitin deacetylation (2/4 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (5/9 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (1/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.1

Sequence Analysis Tools

See A0A160I2U7 at UniProt or InterPro

Protein Sequence (651 amino acids)

>A4249_RS15190 acetate--CoA ligase (Brevundimonas sp. GW460-12-10-14-LB2)
MPETSRVPDPALYPVPADWADKAHMDRETYEAARIAARETPDAFWAEQAKRLDWITPPTR
IKDVSFNKEDFRIRWFEDGVLNVSANCIDRHLPHREDETAIIWEGDDPADSRHITFGELH
AEVCRMANVLKAHGAKKGDRITLYLPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLCGR
IEDCGSNLVITADEGLRGGKHIPLKANVDEALTKVKVDTVLVIRRTGADVPMIKGRDFDY
GLEAAKADADCPPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLFWAAWTHEIVFDYRP
GEVFWCTADVGWVTGHSYMVYGPLANAATTLMFEGVPNYPDAGRFWQVVDKHKVEIFYTA
PTALRALMREGDAPVKASSRASLRLLGTVGEPINPEAWRWYHEVVGDGRCPIVDTWWQTE
TGGHLITPLPGATDLKPGSATLPLPGVELEIVDAEGQPLEGAVSGNLCITDSWPGQMRTV
YGDDQRFFDTYFSTYPGRYFTGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESALV
LHDDVAEAAVVGYPHDIKGQGIYAYVTLNNGTEATEDLRKALVAHVRHEIGPIAAPDVIQ
WAPGLPKTRSGKIMRRILRKIAENEIGALGDTSTLADPSVVDDLVKNRAGA