Protein Info for A4249_RS15105 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: malonic semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF00881: Nitroreductase" amino acids 31 to 182 (152 residues), 51.5 bits, see alignment E=7.2e-18

Best Hits

Swiss-Prot: 64% identical to Y018_CAUSK: Putative NADH dehydrogenase/NAD(P)H nitroreductase Caul_0018 (Caul_0018) from Caulobacter sp. (strain K31)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 66% identity to cse:Cseg_0013)

MetaCyc: 52% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.298

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I216 at UniProt or InterPro

Protein Sequence (204 amino acids)

>A4249_RS15105 malonic semialdehyde reductase (Brevundimonas sp. GW460-12-10-14-LB2)
MAYDATHQRDVPLSDAALSQLFTEARTRNGWTDRPVAPELLRKLYDLTKFGPTAVNGSPA
RFVFITSPEAKARLIPLMSEGNRDKTQQAPVTVIVGQDMDFHDHLDALFPHAPGAKAWFA
DEAGRRETAFRNASLQGGYLTIAARALGLDVGPMSGFDAAGVKAEFFPDSHVEPNYILNL
GYGSDENLFPRSPRLSFDEAAQIL