Protein Info for A4249_RS15070 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ActS/PrrB/RegB family redox-sensitive histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details PF00512: HisKA" amino acids 228 to 284 (57 residues), 33.8 bits, see alignment 2.9e-12 PF02518: HATPase_c" amino acids 341 to 474 (134 residues), 44.6 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 70% identity to bsb:Bresu_0525)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I203 at UniProt or InterPro

Protein Sequence (484 amino acids)

>A4249_RS15070 ActS/PrrB/RegB family redox-sensitive histidine kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MTSTEARMAPHGASSSEPLNGWSDAPRRGRGFSLRTLIVLRWLTIIGQSAAILTAHQGLH
FPLPLWPCLIVIAISAAVNVGAMARVRRLEASLPDGRTTAIHLGFDIFQLGVLLGLTGGL
ENPFCLLLVAPVTIAAAALPARQALMLGVLALIAVGVLFFWSEPLPWRPHENFHLPTLYR
LGMAMALVTGVVFTAGYAWRVAADAEKLELALATTQDVLQREQRLAALGGLAAAAAHELG
TPLATIQVVAKELQRASAPDSDAAEDAALILQQAERCRGILTQLSQQPEGDDALYADVSL
KALLEEVVEPHRGFDLAFDVLVKTPPGQPAPRVRRMPEVIHGLSTLVENAADFAKTTVRV
QAVVDAGWIEIEILDDGPGFAGDILPRLGEPYVTSRPQGKARQALAAQIAAAARPSKPRA
TVEPPIAPSQGGMGLGFFIARTLLERTGGSVSVGQGLPQSEAKAAPRGARVAVRWARPAL
EVAA