Protein Info for A4249_RS14900 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: phosphate/phosphite/phosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 10 to 265 (256 residues), 208.8 bits, see alignment E=5e-66 PF12974: Phosphonate-bd" amino acids 46 to 294 (249 residues), 210.2 bits, see alignment E=1.7e-66

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 75% identity to bsb:Bresu_3248)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1I3 at UniProt or InterPro

Protein Sequence (338 amino acids)

>A4249_RS14900 phosphate/phosphite/phosphonate ABC transporter substrate-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSLSRISPTRRLIAAAGAAVMILGLAACGGGEDKKAAGGAPSEITFSILSAEGQASAGPL
WQPLLDDMSKAIGVPVKPYFGSNYTVLVEAMRGNHTQVGWFSAKPEVEAIDRAKAEVIAR
TVNREGLDSYQSTLIVKKGSGITLDQVMACGKKYNFGIGDAQSTSGTLAPLTFLFNPRGV
VPSQCFKTVRSANHQANAFGVATGVIDVATSNSVNTIFMRKENPQLAGQIEEIWTSPPIP
ESGIVVREDLDPAVKEKIRGFFLTYGQGEGAEAERQRKVLADLEYSRFTAADDSYLDPIR
EMIADQKLGEARAKGDTAAAAAAERELQRLRSLREVRP