Protein Info for A4249_RS14895 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 217 to 233 (17 residues), see Phobius details amino acids 239 to 239 (1 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 26 to 269 (244 residues), 292.2 bits, see alignment E=1.6e-91 PF00528: BPD_transp_1" amino acids 98 to 269 (172 residues), 78.1 bits, see alignment E=3.8e-26

Best Hits

Swiss-Prot: 54% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 79% identity to bsb:Bresu_3247)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1Z1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>A4249_RS14895 phosphonate ABC transporter, permease protein PhnE (Brevundimonas sp. GW460-12-10-14-LB2)
MTAVASPAVAIPAAPKKSALAWVADVLVWGGVAAVLLYSIDAVDLGNISRLFAGNDSTQL
FVHDLLRPDFSDWKMFVAKMWETVQIALWGTFLAVILGIPLGLAAARNIAPVWVVTPVRW
IMNLLRSVPDLVIGLLFVTAVGLGPLAGVLAITLNTAGVLAKLFSEAVESIDKGPVEGVR
ATGAGKLHEIVWGVLPQVAPLWTSFALYRFESNSRSATVLGLIGAGGIGQVLFDSMNAFD
FRAVSAIVIVVVVAVTLIDTLSQVMRRRLL