Protein Info for A4249_RS14825 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF02590: SPOUT_MTase" amino acids 1 to 152 (152 residues), 134.5 bits, see alignment E=1.7e-43

Best Hits

Swiss-Prot: 68% identical to RLMH_CAUSK: Ribosomal RNA large subunit methyltransferase H (rlmH) from Caulobacter sp. (strain K31)

KEGG orthology group: K00783, hypothetical protein (inferred from 88% identity to bsb:Bresu_0141)

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IX79 at UniProt or InterPro

Protein Sequence (154 amino acids)

>A4249_RS14825 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH (Brevundimonas sp. GW460-12-10-14-LB2)
MKLSIVAIGRPGRGPEATLADDYAKRATLSGRALGLGPLELIDLEARRPGKAPEAELILA
AAEGAHLIACDERGKTYSSRAFADHIAKLRDQGERRLVFAIGGADGLDASVREAASSTLA
FGPQTWPHALARAMLAEQLYRAVTILAGSPYHRD