Protein Info for A4249_RS14815 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01467: CTP_transf_like
  • amino acids 34 to 213 (180 residues), 76.5 bits, E=1.1e-25
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 34 to 213 (180 residues), 119.8 bits, E=7.6e-39

Best Hits

Swiss-Prot: 66% identical to NADD_CAUSK: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Caulobacter sp. (strain K31)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 82% identity to bsb:Bresu_0143)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD de novo biosynthesis II (from tryptophan) (5/9 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See A0A160I055 at UniProt or InterPro

Protein Sequence (221 amino acids)

>A4249_RS14815 nicotinate-nucleotide adenylyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MSFFHAGPAPKGAGPRSGALRDGLILAPGMKVGLFGGSFNPAHDGHAHVAETAMRRLDLD
RVVWLVSPQNPLKDARHSAPLADRMASARQHAHGPSMIVSDFESRAGVAWTVDTLRLLVA
RHPGVHFVWLMGSDNLASFHRWRGWTDIMRLMPVAVIARPGSLLDSRTAPAAARFAGFRI
PAQQAGLLPTLQAPAWTYLTAPLNPLSSTAIRTGGGVRATS