Protein Info for A4249_RS14810 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF12697: Abhydrolase_6" amino acids 34 to 281 (248 residues), 73.3 bits, see alignment E=9.4e-24 PF00561: Abhydrolase_1" amino acids 35 to 278 (244 residues), 64.3 bits, see alignment E=2.8e-21 PF12146: Hydrolase_4" amino acids 58 to 176 (119 residues), 47.6 bits, see alignment E=2.7e-16 PF00756: Esterase" amino acids 99 to 138 (40 residues), 24.6 bits, see alignment 3.8e-09

Best Hits

KEGG orthology group: None (inferred from 68% identity to bsb:Bresu_0154)

Predicted SEED Role

"FIG00482611: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2U1 at UniProt or InterPro

Protein Sequence (291 amino acids)

>A4249_RS14810 alpha/beta hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MSPPRRLSVPIDNRWGAGEMAVLDFGDPNRAVDLIFSHANGFNAATYRSLLSPLSASLRI
WAPDLRGHGRSALPTFARPKTSWLDHRDDLLALLEAIDGPPVVMAGHSMGGTASLLAASV
RPDRVSSLVLFDPVIWKRSAVFAFNLPFAHKLMKAIPIAKATLRRRSQFDSREQAMAAYR
GRGAFKGWPDMVLADYLSEGLNEGDGGFSLTAAPAWEAANYAAQAHDPWRAMKRYPGPVR
ILKAEHGALTHVPVQPRGLPNVSVEVVSGGGHLFPMTHADVARDALFDAAV