Protein Info for A4249_RS14770 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 264 to 283 (20 residues), see Phobius details PF07568: HisKA_2" amino acids 354 to 427 (74 residues), 88.1 bits, see alignment E=6.7e-29 PF07536: HWE_HK" amino acids 354 to 418 (65 residues), 24.5 bits, see alignment E=7.7e-09 PF02518: HATPase_c" amino acids 457 to 539 (83 residues), 30.2 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 67% identity to bsb:Bresu_0164)

Predicted SEED Role

"FIG00989364: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NZA0 at UniProt or InterPro

Protein Sequence (564 amino acids)

>A4249_RS14770 sensor histidine kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MAMALLPIFVLSLIQTQADFQRQADDRQVDLQLAAERSASSAKAKLDSAQVLLRALSPDA
VGPYCAPRLTALVGRLEGYEGLYRVSPTGEAVCASGRADGVRSGVAPAAQATWFQRLRNG
EELVVMRAPDGAGYEGALIVATRAERPMGRFDGAMVAVIPFSALQPDVTDAALPSGAQAA
LTDGAGRILTASDPDVFKLSAGDDIAGWVDRARDQGSAVFEAKDAQNQRRDYAGAALAGG
DLYALLSAPAPGWLSWARLNPIGTLLLPLGAWLTAFAAVMLLSERIFIRWLDYLERVAAI
YAKGRFSVRPLQAMNAPSEIRTMARTLDEMAEAITVRDRELTDALAEKDALMREIHHRVK
NNLQIISSLLSMQQRALTDAPAKAALGDTRQRISALALIYRTLYQSNDIRHADAREFLNE
LVGQLVASEAGRGPVVISSVDADSLHVDPDKLAPLALWLVEAVTNAQKHAFAGSGGELKV
RFRVQGEKSVLEVEDNGPGAQAGAEVGVGRTLMSAFAKQLRGETEFATPPGGGTIARMIF
ATPEALAPVDPADKTPGTAALASR