Protein Info for A4249_RS14750 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 307 to 333 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 17 to 334 (318 residues), 133.7 bits, see alignment E=4.5e-43

Best Hits

KEGG orthology group: None (inferred from 75% identity to bsb:Bresu_0351)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1X2 at UniProt or InterPro

Protein Sequence (377 amino acids)

>A4249_RS14750 AI-2E family transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MKNPIATPSWVAARNALGVIATVAAGAAIYWLRDILTPLAMAIFLLIMIDGVKRSVEART
PLNSRMAGIAALTLVVLAFFASIAIIVNGAAGFFGEASGVSQNIGPRIDQIIRDAYGLVR
LANPPTAQDLINGVDVRGWLTSMAFQVQGIASGAFFVLIYLGFLLASQVGFRRKIVAMFP
SEAQRDEAVAVFQRVRGGVEGYIWVQSVTGAMICVVAWILMRAVGLQNAEFWTFVIFIVG
FIPVLGGAVAGLAPPLFALVQFESYWPAAILLVGLQVILFVVGNFIQPRMQGDNQNIDPV
VVLLALAFWGKLWGVVGMFLSTPLAVMAMAILAEFKGSRWMAILLSGDGEPYANEGKTTD
KPKSTRRKPKPVPEAEA