Protein Info for A4249_RS14705 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 512 to 531 (20 residues), see Phobius details PF20154: LNT_N" amino acids 37 to 195 (159 residues), 90.3 bits, see alignment E=1.5e-29 TIGR00546: apolipoprotein N-acyltransferase" amino acids 81 to 482 (402 residues), 294.2 bits, see alignment E=8.8e-92 PF00795: CN_hydrolase" amino acids 244 to 486 (243 residues), 86.4 bits, see alignment E=2.1e-28

Best Hits

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 71% identity to bsb:Bresu_0230)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NZ68 at UniProt or InterPro

Protein Sequence (545 amino acids)

>A4249_RS14705 apolipoprotein N-acyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MFPDALLDRFAAPIRALPDRKRALTWRLIRIVLALLAGAGTAFAHPPFGVLIGLLGYPLL
MILSERSDTARGAFWMGWLAGFAYFFVGCWWVAEAFFVNPEQAWMAPFAASLLPAGLGLF
WGTACALYRRFAPLGAVRVLLFTALFCAAEWLRGHVLTGFPWNPAGATWRAGGGMSQFAS
VVGVYGLSLVTVAATAAFAPLIGPGDKRSRLISAGLGALALIAVGGFGAVRLAQSDLQFT
DTVVRLVQADVKQETKWSPEAYRSIVDRYVTLTGQASARTPNVVVWPEGALPASANDVFA
SADAQAIAGALRPGQTLLMGLARGEPDLTAPEGARYYNSLFALADEGGAGLRVAAVYDKH
RLVPFGEYLPLGSIMTSIGLRSLVHMPSDFSAGPTPAPISVPGAPPAQVLICYESLYPGF
TPGAAGRPEWIVNASNDAWFGATSGPRQHLNLASYRAIEAGLPIARATPTGISAMIDPWG
RIVEGQRLEPGVMGVIDAPLPRPTGVTPYGRFGDFLFFFSVLTAFILSLWPSIRRSRVQG
NQAAI