Protein Info for A4249_RS14650 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: zinc metalloprotease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details PF01435: Peptidase_M48" amino acids 76 to 279 (204 residues), 123.3 bits, see alignment E=5.6e-40

Best Hits

Swiss-Prot: 70% identical to HTPX_CAUSK: Protease HtpX homolog (htpX) from Caulobacter sp. (strain K31)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 70% identity to cak:Caul_3512)

Predicted SEED Role

"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NS17 at UniProt or InterPro

Protein Sequence (321 amino acids)

>A4249_RS14650 zinc metalloprotease HtpX (Brevundimonas sp. GW460-12-10-14-LB2)
MNHLKTFILLAAMTALFAGVGYLIGGATGMAIALLFAGGMNLFSYWNADKIVLKMYRAQP
VDEQHPNAVVRNYVADVRQMARDAGLPQPQVAIIPNDQPNAFATGRNPENAAVCATTGLL
DMLTREEVRGVMAHELAHVKNRDTLIMTVTATIAGAIAALANFALFFGGNDRERPGGVIG
TIALMLLAPMAAGLVQMAISRGREYEADRVGAEIAGDPQALASALQKIDAYARRITNQTA
ERNPASGQMFIINPLAGRGADNLFSTHPATGNRVRALMELGAKMGIQSRARTPDLTQPRP
AAGFTTTGVPTTPTEPRGPWG