Protein Info for A4249_RS14645 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: M20/M25/M40 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04389: Peptidase_M28" amino acids 284 to 502 (219 residues), 114.2 bits, see alignment E=6.5e-37 PF01546: Peptidase_M20" amino acids 313 to 505 (193 residues), 28.9 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 78% identity to bsb:Bresu_2498)

Predicted SEED Role

"Aminopeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NRZ3 at UniProt or InterPro

Protein Sequence (535 amino acids)

>A4249_RS14645 M20/M25/M40 family metallo-hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MSRLLAFVSAAALLATPVAAQSVDRVAVNGIIDQGLNHSQVMQTAAYLTDRIGGRMTNSP
QMREAERWAQQQFRDYGLSDVRAEGFEFGRGWSIVRSSARMTAPRPLDLRAIPVAWTPST
NGVISGGVIVAPISKVEDFDKWRGKLSGKIVMLSQPGTGSEPTEPAFRRWTSAELAERNT
YNQPQHSPAAIERSLKTVNFATQLDAFLAEQGALAWVRISQRDGGLLHGTGYTYQVGATP
KLAGMELAAEDYRRLARLALTDAPPTLELMSEVRFHDEDVNAYNILADIPGTARGTEYVM
AGAHLDSWVASDGAVDNAAGSAVVMEAARILKALNVKPKRTIRFALWNGEEQGILGSLAY
VDRHLATRAASNDPALAGLPDNRTWRSRWPIEPRAGYRDLVAYFNLDNGSGKIRGINAEG
NVAAAPIFQEWLAPFASMGATTVSLRNSGGTDHVYMQTVGVPGYQFIQDPLDYSSRLHHT
SIDSYDHLKADDLRQAAVILASFLLNAANRDEPLPRMPLPTQPTPSDPFEYPTAD