Protein Info for A4249_RS14555 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: multidrug effflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 14 to 15 (2 residues), see Phobius details transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 19 to 387 (369 residues), 211.8 bits, see alignment E=1.1e-66 PF07690: MFS_1" amino acids 24 to 365 (342 residues), 133.4 bits, see alignment E=1.4e-42 PF06609: TRI12" amino acids 34 to 177 (144 residues), 27.3 bits, see alignment E=2e-10 PF00083: Sugar_tr" amino acids 55 to 196 (142 residues), 29.8 bits, see alignment E=4.7e-11

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 70% identity to bsb:Bresu_0690)

Predicted SEED Role

"MFS family multidrug efflux protein, similarity to bicyclomycin resistance protein Bcr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1F1 at UniProt or InterPro

Protein Sequence (416 amino acids)

>A4249_RS14555 multidrug effflux MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MSSSLASASAKKELGFVEFVCLIALMMALNALAIDSMLPALPHIGADLNVATDNDRQWVV
TAYLLGFGGAQLFYGPLADRFGRKPVLLFGVGVYVMFSLLATLAPTFETLIMARVGQGLG
SACTRVLAVSIVRDRYEGRTMARVMSFSFLVFLGVPILAPSLGQMIMLVGPWRWIFAGLG
LIGVGLIVWASLRLPETLKPEDRLPIQVKRLVSAYKIALTDRTAVGYTLAMTAITGALFG
FINSSQQIFADVFHAEAAFPAIFALIAGGIAVASIVNARLVVKLGSRKISHTALIGFTSI
AAIHAVVAISGLESIWTFAVLQTLTMFCFGLIAGNFGSMAMETMGKIAGTAASIQGFIST
IVGSLLGFAVGQQFNGTTIPMSVGFTVFGLVALGWVLFAERGRLFRAHHAPVAAKA