Protein Info for A4249_RS14505 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 290 (290 residues), 253.8 bits, see alignment E=9.3e-80 PF01149: Fapy_DNA_glyco" amino acids 1 to 127 (127 residues), 104.6 bits, see alignment E=7.8e-34 PF06831: H2TH" amino acids 144 to 234 (91 residues), 86.3 bits, see alignment E=1.7e-28 PF06827: zf-FPG_IleRS" amino acids 269 to 292 (24 residues), 24.1 bits, see alignment (E = 4e-09)

Best Hits

Swiss-Prot: 58% identical to FPG_CAUSK: Formamidopyrimidine-DNA glycosylase (mutM) from Caulobacter sp. (strain K31)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 81% identity to bsb:Bresu_0012)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1T3 at UniProt or InterPro

Protein Sequence (292 amino acids)

>A4249_RS14505 bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase (Brevundimonas sp. GW460-12-10-14-LB2)
MPELPEVETVRRGLTPVLEGARLSRVRINRLDLRFPFPERFVERLEGATVMRIDRRAKYL
LMPLSTGETWITHLGMTGRFTLDGTLLGEFEEAAPIAGKHEHFSACAIRDGAATRIGYAD
ARRFGFMGLISSDQVETHPWFAGLGPEPLGNGFSGAHLVEAFAGKKQNIKVSLLDQWIVA
GLGNIYVCEALYRARISPLVAAGSVSKARLERLATEVRNVLNDAIAAGGSTLRDFANAEG
GQGYFQHRFDVYGREGEPCRGNGGRGDKCTGVVARIVQGGRSTFYCPSCQKR