Protein Info for A4249_RS14500 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: oligopeptide transporter, OPT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 292 to 320 (29 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details amino acids 409 to 431 (23 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details amino acids 477 to 497 (21 residues), see Phobius details amino acids 514 to 532 (19 residues), see Phobius details amino acids 541 to 560 (20 residues), see Phobius details amino acids 572 to 597 (26 residues), see Phobius details amino acids 616 to 639 (24 residues), see Phobius details amino acids 654 to 675 (22 residues), see Phobius details TIGR00733: oligopeptide transporter, OPT family" amino acids 13 to 638 (626 residues), 614.9 bits, see alignment E=1.5e-188 TIGR00728: oligopeptide transporter, OPT superfamily" amino acids 13 to 633 (621 residues), 297.3 bits, see alignment E=2.6e-92 PF03169: OPT" amino acids 13 to 634 (622 residues), 339.7 bits, see alignment E=2e-105

Best Hits

KEGG orthology group: None (inferred from 85% identity to bsb:Bresu_0014)

Predicted SEED Role

"oligopeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IJ28 at UniProt or InterPro

Protein Sequence (683 amino acids)

>A4249_RS14500 oligopeptide transporter, OPT family (Brevundimonas sp. GW460-12-10-14-LB2)
MTDAAAAPKGRLELTLRALVLGCLLAVIFTAANTYLGLLVGLTFASAIPAAVISMAVLRA
FRTSTIWENMTVQTVASVGGAMSSIIFVLPGLVMIGWWLEFPFWQSVAICILGGVLGVTF
SIPLRRALVVNGGLPYPEGVAAAEVLKVGSRGAEQTESAVRENKSGLWVVVAGAVVSSGY
ALLVAGRVFAGEAAKFFKLPAALGGGATGMGFGMQFALLGAGHLIGLTVGLAQLFGLVLA
WAIAVPILTSPDTIAWLTAHGIPSIASTLPAGAPAEELATTVWAREVRFMGAGVIGVAAI
WTLIKLAGPLIGGLTSALAANAKRAHGEVLERTEQDLPIKLVGGVSVACLVGIAGLLAWF
AQSAPALAGSTPLLVIGGLVYVVLIGFAVAAICGYMAGLIGSSNSPVSGVGILAIVIASL
LMLGVMAIAGVPADPSIIAFALIVTAVVFAVAVIANDNLQDLKTGQLVEATPWRQQVALI
VGVGAGALVIPFILNLLNQAFGFEGGPPAIVEGAKTLAAPQATLISALARGVIGGDLRWD
LIGLGAAIGVVIIVLDAVVSKATKGKVKLPPLAVGIGFYLPAAVTTMLVIGAVAGWIYDK
AVSSTRYADVARRMGVLLASGLIVGESLFGVFTAGVIVATKDDAPFAMLPEGSAWPAMLA
GIVGFAVAVFGLYAWTRSRASKV