Protein Info for A4249_RS14495 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 37 to 265 (229 residues), 258.7 bits, see alignment E=1.9e-81 PF01209: Ubie_methyltran" amino acids 83 to 193 (111 residues), 22.6 bits, see alignment E=2.2e-08 PF13489: Methyltransf_23" amino acids 85 to 233 (149 residues), 84.9 bits, see alignment E=1.9e-27 PF02353: CMAS" amino acids 87 to 210 (124 residues), 42.4 bits, see alignment E=2e-14 PF13847: Methyltransf_31" amino acids 87 to 211 (125 residues), 57.8 bits, see alignment E=4e-19 PF08241: Methyltransf_11" amino acids 92 to 187 (96 residues), 76.9 bits, see alignment E=5.4e-25 PF13649: Methyltransf_25" amino acids 92 to 184 (93 residues), 63.3 bits, see alignment E=1e-20 PF08242: Methyltransf_12" amino acids 92 to 185 (94 residues), 57.5 bits, see alignment E=6.7e-19

Best Hits

Swiss-Prot: 70% identical to UBIG_CAUVN: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 76% identity to bsb:Bresu_0311)

MetaCyc: 48% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinol 3-O-methyltransferase (EC 2.1.1.64)" (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2T0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>A4249_RS14495 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Brevundimonas sp. GW460-12-10-14-LB2)
MTASNGAAPSRLPQQGHGFSQNSSETAFGASIDPADVARFSAQAAEWWDAHGPFAPLHRF
NPARLALIREQLCTRLGRDPKARAPFEGLTLLDVGCGGGLIAEPMRRMGFEVTAIDASSE
NIGTARAHADMVGLDIAYRAATVEQIEAEGAGPFDVVLTMEVIEHVADPEAFVRACSRLV
RPGGVMMVATLNRTLKSLALGKVAAEYILRWVPAGTHDWRQFLKPDEIRTMLAAEPVTVE
GPYGLNYDPLHDRWSQTDDAGINYMMVATRA