Protein Info for A4249_RS14490 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 8 to 239 (232 residues), 148.5 bits, E=4e-47
• TIGR00657: aspartate kinase
  • amino acids 73 to 420 (348 residues), 353.9 bits, E=7.9e-110
• PF13840: ACT_7
  • amino acids 354 to 417 (64 residues), 53.7 bits, E=2.2e-18

Best Hits

Swiss-Prot: 48% identical to AK_AQUAE: Aspartokinase (lysC) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 90% identity to bsb:Bresu_0312)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• superpathway of L-threonine biosynthesis (5/6 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (9/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• L-homoserine biosynthesis (2/3 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (5/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (5/9 steps found)
• ectoine biosynthesis (2/5 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (4/8 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• superpathway of polyamine biosynthesis III (3/8 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See A0A160I1E4 at UniProt or InterPro

Protein Sequence (424 amino acids)

>A4249_RS14490 aspartate kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MTRPDTTRLVMKFGGTSMGDLERIRRAARIVAAEVSAGKQVAVVVSAMAGKTNELVAWTD
GAGPAAAGLPLSDDEYDVVVASGEQVTSGLLAATLRNMGFNARSWMGWQVPILTDDAHAR
ARIIDIPGEKLGAAVDGGEIAIVPGFQGVTADGKITTLGRGGSDTSAVAVAAALGCPCDI
YTDVDGVYTTDPRIENRARRLAKVSYEEMLEMASLGAKVLQTRSVELAMAKQVPVRVLSS
FIEPDANGVMPDKGGTLICDEEEIVEKRIVSGVTMSRDEARITLLGLSDRVDAPADVFTR
LAEANVNVDMIVQSQSRTAGTVNLTFTTGRRDAVRAADLMTAAKEQLGFEEIRVDEDVAK
VSVVGVGMRSHAGVAQTMFKALADKGVKFQAISTSEIKISVLIDAAYAELAVRALHSAYG
LDAV