Protein Info for A4249_RS14265 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ribosome biogenesis GTP-binding protein YihA/YsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 23 to 208 (186 residues), 210.9 bits, see alignment E=6.3e-67 PF02421: FeoB_N" amino acids 42 to 178 (137 residues), 29.8 bits, see alignment E=6.1e-11 PF01926: MMR_HSR1" amino acids 42 to 160 (119 residues), 68.1 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 71% identical to ENGB_CAUVC: GTP-binding protein EngB (engB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03978, GTP-binding protein (inferred from 90% identity to bsb:Bresu_0712)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NR66 at UniProt or InterPro

Protein Sequence (217 amino acids)

>A4249_RS14265 ribosome biogenesis GTP-binding protein YihA/YsxC (Brevundimonas sp. GW460-12-10-14-LB2)
MIDETEFTPEDIEAARVLFARPATFVMGAAKIEQLPDPDLPEIAFAGRSNVGKSSLINGL
VGMHKLARASNEPGRTREVNFFDLDGRMRLVDLPGYGWAKASKTTVKKFQDLGRDYLRGR
VTLKRVYLLIDSRHGLKSVDTEALDALDLAAVSYQIVLTKADKLKKGEGEAVQAATLKAI
SKRPAAFPVVALTSSEKGLGLPELRAEIMRTTGATLD