Protein Info for A4249_RS13945 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 29 to 260 (232 residues), 267.6 bits, E=2.5e-83
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 32 to 260 (229 residues), 259.4 bits, E=1.1e-81
• PF13489: Methyltransf_23
  • amino acids 67 to 245 (179 residues), 31.3 bits, E=5e-11
• PF13847: Methyltransf_31
  • amino acids 70 to 184 (115 residues), 32 bits, E=3.1e-11
• PF13649: Methyltransf_25
  • amino acids 74 to 175 (102 residues), 53.7 bits, E=8.3e-18
• PF08241: Methyltransf_11
  • amino acids 75 to 179 (105 residues), 58.3 bits, E=3e-19
• PF08242: Methyltransf_12
  • amino acids 75 to 177 (103 residues), 31.6 bits, E=6.7e-11

Best Hits

Swiss-Prot: 72% identical to UBIE_CAUVC: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 86% identity to bsb:Bresu_0045)

MetaCyc: 50% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Arabidopsis thaliana col)
RXN-11754 [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase MenG (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of menaquinol-10 biosynthesis (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of chorismate metabolism (37/59 steps found)
• superpathway of menaquinol-11 biosynthesis (1/10 steps found)
• superpathway of menaquinol-12 biosynthesis (1/10 steps found)
• superpathway of menaquinol-13 biosynthesis (1/10 steps found)
• superpathway of menaquinol-6 biosynthesis (1/10 steps found)
• superpathway of menaquinol-7 biosynthesis (1/10 steps found)
• superpathway of menaquinol-9 biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

See A0A160I1N6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>A4249_RS13945 class I SAM-dependent methyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDASSHGPHSSGDRSSFGFRDVDAREKVKMVRGVFDSVASNYDVMNDLMSVGVHRIWKD
IAAAKLNPRPGETILDVAGGTGDMARRYSKMARAAQERRGGEDANVIVLDYNAEMILAGV
HKGGEPEMQWSVGDAMNLPLPDASVDAYSISFGIRNVAHIDKALAEARRVLKPGGRFLCL
EFSRPTTTPIRKVYDAWSFHAIPRIGGWVAKDRDSYQYLVESIRRFPDQNTFKGMIEDAG
FRRVSVTNLSGGIAAIHHGWAI