Protein Info for A4249_RS13705 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 9 to 618 (610 residues), 790.3 bits, see alignment E=5.9e-242 PF00890: FAD_binding_2" amino acids 10 to 42 (33 residues), 23.8 bits, see alignment (E = 7.5e-09) PF12831: FAD_oxidored" amino acids 10 to 154 (145 residues), 31.5 bits, see alignment E=3.7e-11 PF01134: GIDA" amino acids 10 to 400 (391 residues), 537 bits, see alignment E=8.7e-165 PF21680: GIDA_C_1st" amino acids 461 to 552 (92 residues), 55.8 bits, see alignment E=1.9e-18 PF13932: SAM_GIDA_C" amino acids 558 to 621 (64 residues), 81.1 bits, see alignment E=1.6e-26

Best Hits

Swiss-Prot: 71% identical to MNMG_CAUVN: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 80% identity to bsb:Bresu_0369)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NYY2 at UniProt or InterPro

Protein Sequence (626 amino acids)

>A4249_RS13705 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG (Brevundimonas sp. GW460-12-10-14-LB2)
MISPLDFVFDVVVIGGGHAGCEAAAASARAGARTVLLTQKLETIGEMSCNPAIGGLGKGH
LVREIDAMDGVMGRLADVSGIQFRLLNRSKGAAVRGPRSQIDRRLYREAMQAELHGTPNL
TLMAGTAERLILEGDCVVGVVTGGGETVRAGAVVLTTGTFLNGVIHRGDERIPAGRHGEE
PSMGLAADLHAADLMMGRLKTGTPARLDGRTIAWERLEMQQADEEPSAFSFLSDRIDVPQ
IACGVTHTTEETHRIIAENLGESAVYGGKLSGRGPRYCPSIEDKVVRFADKTSHQIFLEP
EGLDDPTVYPNGISTSVSEPIQLAFLRTIPGLEAVEVFRYGYAIEYDYVDPRELTAALEV
KKRPGLYLAGQINGTTGYEEAAAQGLMAGLNAARSAAGQEPVILGRDQAYIGVMIDDLVT
RGVTEPYRMFTSRAEYRLTLRADNADLRLTPLAIELGIVGDERRIRFEGKASALAAASAV
SRETLFTPNQASAIGISVNADGRRRSMRELLAFPDVTLDQFLSAVPLIADWTTEVREQVQ
IDAAYANYLDRQSQDADALKVEEGLMLPTDLDYGAVGGLSNEVKEKLARVQPRTLGQAGR
IEGMTPGALTALLAYVKRAPKASVAA