Protein Info for A4249_RS13675 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 11 to 347 (337 residues), 329.8 bits, E=9.6e-103
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 14 to 349 (336 residues), 358.1 bits, E=2.1e-111

Best Hits

Swiss-Prot: 65% identical to DCUP_PHEZH: Uroporphyrinogen decarboxylase (hemE) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 83% identity to bsb:Bresu_0362)

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from glutamate (7/10 steps found)
• heme b biosynthesis II (oxygen-independent) (2/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (3/6 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (2/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (2/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (1/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

See A0A160I136 at UniProt or InterPro

Protein Sequence (352 amino acids)

>A4249_RS13675 uroporphyrinogen decarboxylase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDQTQTADPTPLVLRALRGDTLERPPVWFMRQAGRYLPEYRKLRSEAPDFIAFCLNPDM
AAEATLQPMRRFGFDAAIVFADILLIPRALGQDVWFETGEGPRLGEMPIPGRMAELAPAA
GEHLSAVGETLSIVRAALEPERALIGFAGAPWTVATYMLDGQARTIGKGERAQARTYAYA
DPERVDETLEVLVEATARYLKMQADAGAQVLKIFESWAEGLPDDLFERLVLKPHQALVKR
TRELGVTVPLIGFPRGSAALAEQYAEAVEVDAVALDTACPLEVGKRVQQIKPIQGALDPL
LLRAGGDLLDRRVDQLMEAWGQGPWLFNLGHGILPDVPIDHVEQVLRRIGAQ