Protein Info for A4249_RS13675 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF01208: URO-D" amino acids 11 to 347 (337 residues), 329.8 bits, see alignment E=9.6e-103 TIGR01464: uroporphyrinogen decarboxylase" amino acids 14 to 349 (336 residues), 358.1 bits, see alignment E=2.1e-111

Best Hits

Swiss-Prot: 65% identical to DCUP_PHEZH: Uroporphyrinogen decarboxylase (hemE) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 83% identity to bsb:Bresu_0362)

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I136 at UniProt or InterPro

Protein Sequence (352 amino acids)

>A4249_RS13675 uroporphyrinogen decarboxylase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDQTQTADPTPLVLRALRGDTLERPPVWFMRQAGRYLPEYRKLRSEAPDFIAFCLNPDM
AAEATLQPMRRFGFDAAIVFADILLIPRALGQDVWFETGEGPRLGEMPIPGRMAELAPAA
GEHLSAVGETLSIVRAALEPERALIGFAGAPWTVATYMLDGQARTIGKGERAQARTYAYA
DPERVDETLEVLVEATARYLKMQADAGAQVLKIFESWAEGLPDDLFERLVLKPHQALVKR
TRELGVTVPLIGFPRGSAALAEQYAEAVEVDAVALDTACPLEVGKRVQQIKPIQGALDPL
LLRAGGDLLDRRVDQLMEAWGQGPWLFNLGHGILPDVPIDHVEQVLRRIGAQ