Protein Info for A4249_RS13670 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: kinase/pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF03618: Kinase-PPPase" amino acids 18 to 273 (256 residues), 290.9 bits, see alignment E=5e-91

Best Hits

Swiss-Prot: 68% identical to PDRP_CAUVC: Putative pyruvate, phosphate dikinase regulatory protein (CC_0001) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K09773, hypothetical protein (inferred from 83% identity to bsb:Bresu_0361)

Predicted SEED Role

"ATP/GTP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1K8 at UniProt or InterPro

Protein Sequence (289 amino acids)

>A4249_RS13670 kinase/pyrophosphorylase (Brevundimonas sp. GW460-12-10-14-LB2)
MSPARPSGPARLATYFHVHLVSDSTGETLNAMAKAVTARFDGVIPIEHIYSLVRSAKQME
RVLQEVESAPGVVLHTLVDRDLREQLEEGCRRLDMPQIGALDPLVGAMSRYLGAALSTRV
GAQHALDHDYFNRIAALDFAMAYDDGQGSLDQLEGADVVLCGVSRTSKTPTCIYLAHRGI
RAANVPLVPGQEDGERLTKLKNPLVIGLTVSPDRLVQIRRNRIDNLNASQSSNYTDQDAV
RDETIKARRAFERRGWPTIDVTRRSVEETAAAITNLLSEHRNHKIGTTW