Protein Info for A4249_RS13660 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 15 to 97 (83 residues), 67.7 bits, E=1.3e-22
• PF01488: Shikimate_DH
  • amino acids 127 to 176 (50 residues), 25.2 bits, 2.3e-09
• PF03807: F420_oxidored
  • amino acids 133 to 196 (64 residues), 31.6 bits, E=3.2e-11

Best Hits

Swiss-Prot: 53% identical to AROE_PHEZH: Shikimate dehydrogenase (NADP(+)) (aroE) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 66% identity to bsb:Bresu_0359)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See A0A160I232 at UniProt or InterPro

Protein Sequence (276 amino acids)

>A4249_RS13660 shikimate dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MSTHRITGAAMVAGIAGNPVAHSLSPVIHNAWLAAGVIDGAYVPFAPADAAGFESLVAAG
RAGLIMGLNVTAPFKEQAFALADQATAAARLTSSANILQFENGRVLADSSDGIGLMSGLK
EQAPDLDVAGRPVVMLGAGGAARAGSGALVEAGAEVRIVNRSPERAQALAADLGPSVRVM
AAGDAFDGAALVINALSVAPSIDFDRIAPGTVVMDMTYKPLATPFLTAARERGLRTVDGL
AMLIGQAAPSFEALFRRAPPPLDLRALLMTHLGETA