Protein Info for A4249_RS13645 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF01113: DapB_N" amino acids 8 to 104 (97 residues), 67.1 bits, see alignment E=1.6e-22 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 46 to 245 (200 residues), 205.2 bits, see alignment E=7e-65 PF05173: DapB_C" amino acids 107 to 244 (138 residues), 149.7 bits, see alignment E=4.6e-48

Best Hits

Swiss-Prot: 62% identical to DAPB_CAUVC: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 83% identity to bsb:Bresu_0386)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZP3 at UniProt or InterPro

Protein Sequence (249 amino acids)

>A4249_RS13645 4-hydroxy-tetrahydrodipicolinate reductase (Brevundimonas sp. GW460-12-10-14-LB2)
MSAIFHAGISGYRGRMGRAVSQVLDAREDVVVAARFDWGETADLSLCDVIIDFSTPAASV
ALAQSAAERGGPALVIGSTGFTDEQEADLMKAAEKVAIVKSGNFSLGVNILIGLVQHAAQ
RLDAQDWDIEITEAHHRRKVDSPSGTALMLGEAAAEGRFADLDDLRSKPYDGVQGERESG
KIGFSSIRAGGIIGEHTVLFASEDEVLTLSHSAIDRSLFAKGAVAAAAWVRTRGPGLYDM
QDVLGFRQA