Protein Info for A4249_RS13640 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR02349: chaperone protein DnaJ" amino acids 4 to 361 (358 residues), 405.4 bits, see alignment E=1.3e-125 PF00226: DnaJ" amino acids 4 to 66 (63 residues), 79.7 bits, see alignment E=2e-26 PF01556: DnaJ_C" amino acids 126 to 346 (221 residues), 160.1 bits, see alignment E=6.3e-51 PF00684: DnaJ_CXXCXGXG" amino acids 153 to 213 (61 residues), 62.9 bits, see alignment E=4.1e-21

Best Hits

Swiss-Prot: 70% identical to DNAJ_CAUVC: Chaperone protein DnaJ (dnaJ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 84% identity to bsb:Bresu_0385)

MetaCyc: 51% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZN7 at UniProt or InterPro

Protein Sequence (400 amino acids)

>A4249_RS13640 molecular chaperone DnaJ (Brevundimonas sp. GW460-12-10-14-LB2)
MARDYYEVLGVERTIDAPGLKAAYRKLAMIHHPDRNGGSEESMAKFKELSEAYTVLSDDN
KRAAYDRYGHAGVNGGGGGNPFGQGGQGFSDINDIFSQVFGDAFGDAFGGRQGRGQQGGP
RRGSDLRYDLEITLEQAYKGEDVEIDIPSTMTCDTCEGSGAKPGTKPVTCTTCQGAGRVR
QANGFFQVERTCPRCHGQGQMIADPCTTCHGHGQVRKTRTLNLKIPAGVDDGSRIRLSGE
GDAGQRGGPRGDLYVFISVTPHDLFERDNLDLLVTVPVPMTVAALGGEIDAPCLVSTACD
GKCKASVAVPAGAQTGKTVRIKGKGMPHLNGRNRGDLVVELFVETPTDLTARQRELLEEL
ALSFGEGQNPRNSSFAGKAKRFWADILGSQDADGSKENAV