Protein Info for A4249_RS13625 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: alpha-ketoglutarate-dependent dioxygenase AlkB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to ALKB_CAUVN: Alpha-ketoglutarate-dependent dioxygenase AlkB homolog (alkB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03919, alkylated DNA repair protein [EC: 1.14.11.-] (inferred from 72% identity to bsb:Bresu_0207)

Predicted SEED Role

"Alkylated DNA repair protein AlkB" in subsystem DNA repair, bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NQE9 at UniProt or InterPro

Protein Sequence (212 amino acids)

>A4249_RS13625 alpha-ketoglutarate-dependent dioxygenase AlkB (Brevundimonas sp. GW460-12-10-14-LB2)
MSVRSANTPIPVEVKTAIEGFRLWPGALDAAAQADLVAEVFARLDDAPLYRPTTPGGRPF
SVQMSNFGRLGWVSDRGGYRYQSTHPETGRPWPAIPTVLLDLWDATVGWPTPPDACLVNL
YRDAAKMGLHQDKDEADLGAPVLSVSLGDTATFRIGAAERGRTTTLRLDSGDICALTGPA
RLARHGVDRVLAGSSRLIPGGGRLNLTLRRAR